HORDB

ID: hor006507
Uniprot ID: Q9Y581
Protein name: Insulin-like peptide INSL6 A chain
Gene name: INSL6
Organism: Homo sapiens (Human)
Family: Insulin family
Source: Human
Expression: Testis specific.
Disease: Diseases associated with INSL6 include Myeloproliferative Neoplasm and Polycythemia Vera.
Comments: NA
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007165 signal transduction; GO:0008150 biological_process
GO CC: GO:0005575 cellular_component; GO:0005576 extracellular region

Sequence: GYSEKCCLTGCTKEELSIACLPYIDF
Length: 26(173-198)
Propeptide: MPRLLRLSLLWLGLLLVRFSRELSDISSARKLCGRYLVKEIEKLCGHANWSQFRFEEETPFSRLIAQASEKVEAYSPYQFESPQTASPARGRGTNPVSTSWEEAVNSWEMQSLPEYKDKKGYSPLGKTREFSSSHNINVYIHENAKFQKKRRNKIKTLSNLFWGHHPQRKRRGYSEKCCLTGCTKEELSIACLPYIDFKRLKEKRSSLVTKIY
Signal peptide: MPRLLRLSLLWLGLLLVRFS
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor006507_AF2.pdb

hor006507_ESM.pdb

Mass:	333346	Formula:	C126H196N28O41S4
Absent amino acids:	HMNQRVW	Common amino acids:	C
pI:	4.15	Basic residues:	2
Polar residues:	12	Hydrophobic residues:	7
Hydrophobicity:	20	Boman Index:	-1608
Half-Life:	30 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	78.85
Instability Index:	7179.23	Extinction Coefficient cystines:	3230
Absorbance 280nm:	129.2

PubMed ID: 10598589
Title: Cloning of two novel mammalian paralogs of relaxin/insulin family proteins and their expression in testis and kidney.
PubMed ID: 10819760
Title: Identification of INSL6, a new member of the insulin family that is expressed in the testis of the human and rat.
PubMed ID: 15164053
Title: DNA sequence and anal
PubMed ID: 15489334
Title: